Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human L-lactate dehydrogenase A chain(LDHA),partial

Recombinant Human L-lactate dehydrogenase A chain(LDHA),partial

SKU:CSB-EP012832HUe1

Regular price $1,223.00 USD
Regular price Sale price $1,223.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Metabolism

Uniprot ID: P00338

Gene Names: LDHA

Organism: Homo sapiens (Human)

AA Sequence: KDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTL

Expression Region: 5-323aa

Sequence Info: Partial

Source: E.coli

Tag Info: NO-tagged

MW: 35.1 kDa

Alternative Name(s): Cell proliferation-inducing gene 19 protein LDH muscle subunit

Relevance:

Reference: "Genotypic analysis of families with lactate dehydrogenase A (M) deficiency by selective DNA amplification." Maekawa M., Sudo K., Li S.S., Kanno T. Hum. Genet. 88:34-38(1991)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details