Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Krueppel-like factor 1(KLF1)

Recombinant Human Krueppel-like factor 1(KLF1)

SKU:CSB-EP619760HUa6

Regular price $1,011.00 USD
Regular price Sale price $1,011.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Epigenetics and Nuclear Signaling

Uniprot ID:Q13351

Gene Names:KLF1

Organism:Homo sapiens (Human)

AA Sequence:MATAETALPSISTLTALGPFPDTQDDFLKWWRSEEAQDMGPGPPDPTEPPLHVKSEDQPGEEEDDERGADATWDLDLLLTNFSGPEPGGAPQTCALAPSEASGAQYPPPPETLGAYAGGPGLVAGLLGSEDHSGWVRPALRARAPDAFVGPALAPAPAPEPKALALQPVYPGPGAGSSGGYFPRTGLSVPAASGAPYGLLSGYPAMYPAPQYQGHFQLFRGLQGPAPGPATSPSFLSCLGPGTVGTGLGGTAEDPGVIAETAPSKRGRRSWARKRQAAHTCAHPGCGKSYTKSSHLKAHLRTHTGEKPYACTWEGCGWRFARSDELTRHYRKHTGQRPFRCQLCPRAFSRSDHLALHMKRHL

Expression Region:1-362aa

Sequence Info:Full Length

Source:E.coli

Tag Info:N-terminal 6xHis-B2M-tagged

MW:52.2 kDa

Alternative Name(s):Erythroid krueppel-like transcription factor (EKLF) (EKLF)

Relevance:Transcription regulator of erythrocyte development that probably serves as a general switch factor during erythropoiesis. Is a dual regulator of fetal-to-adult globin switching. Binds to the CACCC box in the beta-globin gene promoter and acts as a preferential activator of this gene. Furthermore, it binds to the BCL11A promoter and activates expression of BCL11A, which in turn represses the HBG1 and HBG2 genes. This dual activity ensures that, in most adults, fetal hemoglobin levels are low. Able to activate CD44 and AQP1 promoters. When sumoylated, acts as a transcriptional repressor by promoting interaction with CDH2/MI2beta and also represses megakaryocytic differentiation.

Reference:"Structural and functional characterization of an atypical activation domain in erythroid Kruppel-like factor (EKLF)." Mas C., Lussier-Price M., Soni S., Morse T., Arseneault G., Di Lello P., Lafrance-Vanasse J., Bieker J.J., Omichinski J.G. Proc. Natl. Acad. Sci. U.S.A. 108:10484-10489(2011)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Transcription regulator of erythrocyte development that probably serves as a general switch factor during erythropoiesis. Is a dual regulator of fetal-to-adult globin switching. Binds to the CACCC box in the beta-globin gene promoter and acts as a preferential activator of this gene. Furthermore, it binds to the BCL11A promoter and activates expression of BCL11A, which in turn represses the HBG1 and HBG2 genes. This dual activity ensures that, in most adults, fetal hemoglobin levels are low. Able to activate CD44 and AQP1 promoters. When sumoylated, acts as a transcriptional repressor by promoting interaction with CDH2/MI2beta and also represses megakaryocytic differentiation.

Involvement in disease:Anemia, congenital dyserythropoietic, 4 (CDAN4)

Subcellular Location:Nucleus

Protein Families:Krueppel C2H2-type zinc-finger protein family

Tissue Specificity:Expression restricted to adult bone marrow and fetal liver. Not expressed in myeloid nor lymphoid cell lines.

Paythway:

HGNC Database Link:https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:6345

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Hs&CID=37860

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?hsa:10661

STRING Database Link:https://string-db.org/network/9606.ENSP00000264834

OMIM Database Link:https://www.omim.org/entry/111150111150111150

Lead Time Guidance:13-23 business days

View full details