Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Killer cell immunoglobulin-like receptor 3DL2(KIR3DL2)

Recombinant Human Killer cell immunoglobulin-like receptor 3DL2(KIR3DL2)

SKU:CSB-CF012365HU

Regular price $2,092.00 USD
Regular price Sale price $2,092.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P43630

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLHVLIGTSVVIFLFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQLDHCVFIQRKISRPSQRPKTPLTDTSVYTELPNAEPRSKVVSCPRAPQSGLEGVF

Protein Names:Recommended name: Killer cell immunoglobulin-like receptor 3DL2 Alternative name(s): CD158 antigen-like family member K MHC class I NK cell receptor Natural killer-associated transcript 4 Short name= NKAT-4 p70 natural killer cell receptor clone CL-5 Short name= p70 NK receptor CL-5 CD_antigen= CD158k

Gene Names:Name:KIR3DL2 Synonyms:CD158K, NKAT4

Expression Region:22-455

Sequence Info:full length protein

View full details