Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Killer cell immunoglobulin-like receptor 2DL2(KIR2DL2)

Recombinant Human Killer cell immunoglobulin-like receptor 2DL2(KIR2DL2)

SKU:CSB-CF012353HU

Regular price $2,017.00 USD
Regular price Sale price $2,017.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P43627

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVIGNPSNSWPSPTEPSSKTGNPRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEVTYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYAELPNAESRSKVVSCP

Protein Names:Recommended name: Killer cell immunoglobulin-like receptor 2DL2 Alternative name(s): CD158 antigen-like family member B1 MHC class I NK cell receptor Natural killer-associated transcript 6 Short name= NKAT-6 p58 natural killer cell receptor clone CL-43 Short name= p58 NK receptor CL-43 CD_antigen= CD158b1

Gene Names:Name:KIR2DL2 Synonyms:CD158B1, NKAT6

Expression Region:22-348

Sequence Info:full length protein

View full details