Recombinant Human Killer cell immunoglobulin-like receptor 2DL1(KIR2DL1)

SKU: CSB-CF012352HU

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P43626

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEVTYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAESRSKVVSCP

Protein Names:Recommended name: Killer cell immunoglobulin-like receptor 2DL1 Alternative name(s): CD158 antigen-like family member A MHC class I NK cell receptor Natural killer-associated transcript 1 Short name= NKAT-1 p58 natural killer cell receptor clones CL-42/47.11 Short name= p58 NK receptor CL-42/47.11 p58.1 MHC class-I-specific NK receptor CD_antigen= CD158a

Gene Names:Name:KIR2DL1 Synonyms:CD158A, NKAT1

Expression Region:22-348

Sequence Info:full length protein