Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Keratinocyte-associated protein 3(KRTCAP3)

Recombinant Human Keratinocyte-associated protein 3(KRTCAP3)

SKU:CSB-CF703622HU

Regular price $1,850.00 USD
Regular price Sale price $1,850.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q53RY4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRRCSLCAFDAARGPRRLMRVGLALILVGHVNLLLGAVLHGTVLRHVANPRGAVTPEYTV ANVISVGSGLLSVSVGLVALLASRNLLRPPLHWVLLALALVNLLLSVACSLGLLLAVSLT VANGGRRLIADCHPGLLDPLVPLDEGPGHTDCPFDPTRIYDTALALWIPSLLMSAGEAAL SGYCCVAALTLRGVGPCRKDGLQGQLEEMTELESPKCKRQENEQLLDQNQEIRASQRSWV

Protein Names:Recommended name: Keratinocyte-associated protein 3 Short name= KCP-3

Gene Names:Name:KRTCAP3 Synonyms:KCP3 ORF Names:UNQ3066/PRO9898

Expression Region:1-240

Sequence Info:full length protein

View full details