Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Kallikrein-7(KLK7)

Recombinant Human Kallikrein-7(KLK7)

SKU:CSB-YP012458HU

Regular price $935.00 USD
Regular price Sale price $935.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Cancer

Uniprot ID: P49862

Gene Names: KLK7

Organism: Homo sapiens (Human)

AA Sequence: DKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR

Expression Region: 28-253aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 26.7 kDa

Alternative Name(s): Serine protease 6Stratum corneum chymotryptic enzyme ;hSCCE

Relevance: May catalyze the degradation of intercellular cohesive structures in the cornified layer of the skin in the continuous shedding of cells from the skin surface. Specific for amino acid residues with aromatic side chains in the P1 position. Cleaves insulin A chain at '14-Tyr-|-Gln-15' and insulin B chain at '6-Leu-|-Cys-7', '16-Tyr-|-Leu-17', '25-Phe-|-Tyr-26' and '26-Tyr-|-Thr-27'. Could play a role in the activation of precursors to inflammatory cytokines.

Reference: Cloning, expression, and characterization of stratum corneum chymotryptic enzyme. A skin-specific human serine proteinase.Hansson L., Stroemqvist M., Baeckman A., Wallbrandt P., Carlstein A., Egelrud T.J. Biol. Chem. 269:19420-19426(1994)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details