GeneBio Systems
Recombinant Human Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial (IDH3G)
Recombinant Human Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial (IDH3G)
SKU:P51553
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Signal Transduction
Uniprot ID: P51553
Gene Names: IDH3G
Alternative Name(s): Isocitric dehydrogenase subunit gammaNAD(+)-specific ICDH subunit gamma
Abbreviation: Recombinant Human IDH3G protein
Organism: Homo sapiens (Human)
Source: E.coli
Expression Region: 40-393aa
Protein Length: Full Length of Mature Protein
Tag Info: N-terminal 6xHis-SUMO-tagged
Target Protein Sequence: FSEQTIPPSAKYGGRHTVTMIPGDGIGPELMLHVKSVFRHACVPVDFEEVHVSSNADEEDIRNAIMAIRRNRVALKGNIETNHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKDIDILIVRENTEGEYSSLEHESVAGVVESLKIITKAKSLRIAEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVAARYPQITFENMIVDNTTMQLVSRPQQFDVMVMPNLYGNIVNNVCAGLVGGPGLVAGANYGHVYAVFETATRNTGKSIANKNIANPTATLLASCMMLDHLKLHSYATSIRKAVLASMDNENMHTPDIGGQGTTSEAIQDVIRHIRVINGRAVEA
MW: 54.8 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20ā/-80ā. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20ā/-80ā. The shelf life of lyophilized form is 12 months at -20ā/-80ā.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4ā for up to one week.
Relevance:
Reference: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96: 253-262(2014)
Function: Regulatory subunit which plays a role in the allosteric regulation of the enzyme catalyzing the decarboxylation of isocitrate (ICT) into alpha-ketoglutarate. The heterodimer composed of the alpha (IDH3A) and beta (IDH3B) subunits and the heterodimer composed of the alpha (IDH3A) and gamma (IDH3G) subunits, have considerable basal activity but the full activity of the heterotetramer (containing two subunits of IDH3A, one of IDH3B and one of IDH3G) requires the assembly and cooperative function of both heterodimers.
![Recombinant Human Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial (IDH3G)](http://www.genebiosystems.com/cdn/shop/files/no_image_default_image-jpeg_84aaba51-e43b-494e-bf02-ec88a7fc4128.jpg?v=1769108880&width=1445)