Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Interleukin-3(IL3)

Recombinant Human Interleukin-3(IL3)

SKU:CSB-EP011652HUc7

Regular price $753.00 USD
Regular price Sale price $753.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Immunology

Uniprot ID: P08700

Gene Names: IL3

Organism: Homo sapiens (Human)

AA Sequence: APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Expression Region: 20-152aa

Sequence Info: Full Length of Mature Protein

Source: E.coli

Tag Info: C-terminal 6xHis-tagged

MW: 17.1 kDa

Alternative Name(s): Hematopoietic growth factor Mast cell growth factor

Relevance: Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.

Reference: "Association between a single-nucleotide polymorphism in the promoter of the human interleukin-3 gene and rheumatoid arthritis in Japanese patients, and maximum-likelihood estimation of combinatorial effect that two genetic loci have on susceptibility to the disease." Yamada R., Tanaka T., Unoki M., Nagai T., Sawada T., Ohnishi Y., Tsunoda T., Yukioka M., Maeda A., Suzuki K., Tateishi H., Ochi T., Nakamura Y., Yamamoto K. Am. J. Hum. Genet. 68:674-685(2001)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details