Recombinant Human Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (ITPRIPL1), partial (Active)

SKU: Q6GPH6

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Others

Uniprot ID: Q6GPH6

Gene Names: ITPRIPL1

Alternative Name(s): ITPRIPL1; KIAA1754L; Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1

Abbreviation: Recombinant Human ITPRIPL1 protein, partial (Active)

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 25-103aa

Protein Length: Partial

Tag Info: C-terminal 10xHis-tagged

Target Protein Sequence: HPLMVSDRMDLDTLARSRQLEKRMSEEMRLLEMEFEERKRAAEQRQKAENFWTGDTSSDQLVLGKKDMGWPFQADGQEG

MW: 10.7 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Human ITPRIPL1 at 2 μg/mL can bind Anti-ITPRIPL1 recombinant antibody (CSB-RA756966MA1HU). The EC50 is 6.537-7.663 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance:

Reference: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Wilson R.K. Nature 434: 724-731 (2005)

Function: