Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human ICOS ligand(ICOSLG)

Recombinant Human ICOS ligand(ICOSLG)

SKU:CSB-CF010958HU

Regular price $1,964.00 USD
Regular price Sale price $1,964.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O75144

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV

Protein Names:Recommended name: ICOS ligand Alternative name(s): B7 homolog 2 Short name= B7-H2 B7-like protein Gl50 B7-related protein 1 Short name= B7RP-1 CD_antigen= CD275

Gene Names:Name:ICOSLG Synonyms:B7H2, B7RP1, ICOSL, KIAA0653

Expression Region:19-302

Sequence Info:full length protein

View full details