Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Homogentisate 1,2-dioxygenase(HGD)

Recombinant Human Homogentisate 1,2-dioxygenase(HGD)

SKU:CSB-EP842354HU

Regular price $1,059.00 USD
Regular price Sale price $1,059.00 USD
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Metabolism

Target / Protein: HGD

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: Q93099

AA Sequence: MAELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSHKPFESIDEGQVTHNWDEVDPDPNQLRWKPFEIPKASQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNTSMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVFEETRGYILEVYGVHFELPDLGPIGANGLANPRDFLIPIAWYEDRQVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVLTAKSVRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCMSEFMGLIRGHYEAKQGGFLPGGGSLHSTMTPHGPDADCFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLDENYHKCWEPLKSHFTPNSRNPAEPN

Tag info: N-terminal 6xHis-tagged

Expression Region: 1-445aa

Protein length: Full Length

MW: 54.0 kDa

Alternative Name(s): Homogentisate oxygenase Homogentisic acid oxidase Homogentisicase

Relevance:

Reference: "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details