GeneBio Systems
Recombinant Human HLA-DRB1&HLA-DRA Heterodimer Protein-VLPs
Recombinant Human HLA-DRB1&HLA-DRA Heterodimer Protein-VLPs
SKU:D7RIG5&P01903
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Immunology
Uniprot ID: D7RIG5&P01903
Gene Names: HLA-DRB1&HLA-DRA
Alternative Name(s):
Abbreviation: Recombinant Human HLA-DRB1&HLA-DRA Heterodimer protein-VLPs
Organism: Homo sapiens (Human)
Source: Mammalian cell
Expression Region: 30-266aa&26-254aa
Protein Length: Heterodimer
Tag Info: C-terminal 10xHis-tagged & C-terminal Flag-tagged (This tag can be tested only under denaturing conditions)
Target Protein Sequence: GDTQPRFLWQGKYKCHFFNGTERVQFLERLFYNQEEFVRFDSDVGEYRAVTELGRPVAESWNSQKDILEDRRGQVDTVCRHNYGVGESFTVQRRVHPEVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVMSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS&IKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREPNVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLPSTEDVYDCRVEHWGLDEPLLKHWEFDAPSPLPETTENVVCALGLTVGLVGIIIGTIFIIKGVRKSNAAERRGPL
MW: 28.3 kDa&27.0 kDa
Purity: The purity information is not available for VLPs proteins.
Endotoxin: Not test
Biological_Activity:
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20℃/-80℃ upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
Relevance:
Reference:
Function:
