Gene Bio Systems
Recombinant Human HLA-DMA protein(HLA-DMA),partial
Recombinant Human HLA-DMA protein(HLA-DMA),partial
SKU:CSB-EP338892HU
Couldn't load pickup availability
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171228
Research areas: Cardiovascular
Target / Protein: HLA-DMA
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Homo sapiens (Human)
Delivery time: 3-7 business days
Uniprot ID: Q6ICR9
AA Sequence: VPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLC
Tag info: N-terminal 6xHis-tagged
Expression Region: 27-233aa
Protein length: Partial
MW: 27.4 kDa
Alternative Name(s):
Relevance:
Reference: "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.Submitted (MAY-2004)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
