Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)
Uniprot NO.:Q69550
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDVWKRQRLQECRELCPLPVLMSLSNMFSKIEIVYVKYLFKMDFSTMYRYILPALTLSMT VTKSLVIEMLFILKRWEDIDQFFRLNIRKVNDCFIVAQFNHIPIKRWVLI
Protein Names:Recommended name: Uncharacterized protein U15
Gene Names:Name:U15 Synonyms:EFLF3
Expression Region:1-110
Sequence Info:full length protein