Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Hereditary hemochromatosis protein(HFE),partial

Recombinant Human Hereditary hemochromatosis protein(HFE),partial

SKU:CSB-EP653744HU

Regular price $1,018.00 USD
Regular price Sale price $1,018.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Metabolism

Uniprot ID:Q30201

Gene Names:HFE

Organism:Homo sapiens (Human)

AA Sequence:RLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPSPSGTLV

Expression Region:23-306aa

Sequence Info:Extracellular Domain

Source:E.coli

Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW:40.2 kDa

Alternative Name(s):HLA-H

Relevance:Binds to transferrin receptor (TFR) and reduces its affinity for iron-loaded transferrin.

Reference:"The haemochromatosis candidate gene HFE (HLA-H) of man and mouse is located in syntenic regions within the histone gene." Albig W., Drabent B., Burmester N., Bode C., Doenecke D. J. Cell. Biochem. 69:117-126(1998)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Binds to transferrin receptor (TFR) and reduces its affinity for iron-loaded transferrin.

Involvement in disease:Hemochromatosis 1 (HFE1); Variegate porphyria (VP); Microvascular complications of diabetes 7 (MVCD7)

Subcellular Location:Cell membrane, Single-pass type I membrane protein

Protein Families:MHC class I family

Tissue Specificity:Expressed in all tissues tested except brain.

Paythway:

HGNC Database Link:https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:4886

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Hs&CID=233325

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?hsa:3077

STRING Database Link:https://string-db.org/network/9606.ENSP00000417404

OMIM Database Link:https://www.omim.org/entry/176200176200176200

Lead Time Guidance:3-7 business days

View full details