Gene Bio Systems
Recombinant Human Heart- and neural crest derivatives-expressed protein 2(HAND2)
Recombinant Human Heart- and neural crest derivatives-expressed protein 2(HAND2)
SKU:CSB-EP010126HU
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Epigenetics and Nuclear Signaling
Uniprot ID: P61296
Gene Names: HAND2
Organism: Homo sapiens (Human)
AA Sequence: MSLVGGFPHHPVVHHEGYPFAAAAAASRCSHEENPYFHGWLIGHPEMSPPDYSMALSYSPEYASGTANRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELKQ
Expression Region: 1-180aa
Sequence Info: Full Length of Isoform 2
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 47.3 kDa
Alternative Name(s): Class A basic helix-loop-helix protein 26
Relevance: Essential for cardiac morphogenesis, particularly for the formation of the right ventricle and of the aortic arch arteries. Required for vascular development and regulation of angiogenesis, possibly through a VEGF signaling pathway. Plays also an important role in limb development, particularly in the establishment of anterior-posterior polarization, acting as an upstream regulator of sonic hedgehog (SHH) induction in the limb bud. Is involved in the development of branchial arches, which give rise to unique structures in the head and neck. Binds DNA on E-box consensus sequence 5'-CANNTG-3'
Reference: "Co-regulated expression of HAND2 and DEIN by a bidirectional promoter with asymmetrical activity in neuroblastoma." Voth H., Oberthuer A., Simon T., Kahlert Y., Berthold F., Fischer M. BMC Mol. Biol. 10:28-28(2009)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
