Gene Bio Systems
Recombinant Human Guanylate kinase(GUK1)
Recombinant Human Guanylate kinase(GUK1)
SKU:CSB-EP619089HU
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Cancer
Uniprot ID: Q16774
Gene Names: GUK1
Organism: Homo sapiens (Human)
AA Sequence: SGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
Expression Region: 2-197aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 37.6 kDa
Alternative Name(s): GMP kinase
Relevance: Essential for recycling GMP and indirectly, cGMP.
Reference: "Human guanylate kinase (GUK1): cDNA sequence, expression and chromosomal localisation."Fitzgibbon J., Katsanis N., Wells D., Delhanty J., Vallins W., Hunt D.M.FEBS Lett. 385:185-188(1996)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
