Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Growth hormone receptor(GHR),partial,Biotinylated (Active)

Recombinant Human Growth hormone receptor(GHR),partial,Biotinylated (Active)

SKU:CSB-MP009411HUj1-B

Regular price $747.00 USD
Regular price Sale price $747.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. Please contact us.

Research Areas:Neuroscience

Uniprot NO.:P10912

Uniprot Entry Name:

Gene Names:GHR

Species:Homo sapiens (Human)

Source:Mammalian cell

Expression Region:27-264aa

Sequence:AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFY

Protein Description:Partial

Tag Info:C-terminal mFc-Avi-tagged

Mol. Weight:56.6

Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized human GH1 (CSB-MP009407HU) at 2 ?g/ml can bind Biotinylated human GHR, the EC50 is 2.067-3.208 ng/ml.

Purity:Greater than 95% as determined by SDS-PAGE.

Endotoxin:Less than 1.0 EU/ug as determined by LAL method.

Form:Lyophilized powder

Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:

Relevance:

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

View full details