
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170725
Research areas: Signal Transduction
Target / Protein: MSTN
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Homo sapiens (Human)
Delivery time: 3-7 business days
Uniprot ID: O14793
AA Sequence: DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Tag info: N-terminal 6xHis-tagged
Expression Region: 267-375aa
Protein length: Full Length of Mature Protein
MW: 16.4 kDa
Alternative Name(s): Myostatin
Relevance: Acts specifically as a negative regulator of skeletal muscle growth.
Reference: Double muscling in cattle due to mutations in the myostatin gene.McPherron A.C., Lee S.-J.Proc. Natl. Acad. Sci. U.S.A. 94:12457-12461(1997)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.