Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Growth-differentiation factor 8(MSTN)

Recombinant Human Growth-differentiation factor 8(MSTN)

SKU:CSB-RP118694h

Regular price $752.00 USD
Regular price Sale price $752.00 USD
Sale Sold out
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: Signal Transduction

Target / Protein: MSTN

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: O14793

AA Sequence: DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Tag info: N-terminal 6xHis-tagged

Expression Region: 267-375aa

Protein length: Full Length of Mature Protein

MW: 16.4 kDa

Alternative Name(s): Myostatin

Relevance: Acts specifically as a negative regulator of skeletal muscle growth.

Reference: Double muscling in cattle due to mutations in the myostatin gene.McPherron A.C., Lee S.-J.Proc. Natl. Acad. Sci. U.S.A. 94:12457-12461(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)