Recombinant Human Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial(GATC)

Recombinant Human Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial(GATC)

CSB-EP009283HU
Regular price
$539.00 USD
Sale price
$539.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: O43716

Gene Names: GATC

Organism: Homo sapiens (Human)

AA Sequence: MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQNSHRVVEEYFVAPPGNISLPKLDEQEPFPHS

Expression Region: 1-136aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 42.1 kDa

Alternative Name(s): Protein 15E1.2

Relevance: Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).

Reference: "Biogenesis of glutaminyl-mt tRNAGln in human mitochondria." Nagao A., Suzuki T., Katoh T., Sakaguchi Y., Suzuki T. Proc. Natl. Acad. Sci. U.S.A. 106:16209-16214(2009)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.