Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Glucagon-like peptide 2 receptor (GLP2R), partial, Biotinylated

Recombinant Human Glucagon-like peptide 2 receptor (GLP2R), partial, Biotinylated

SKU:O95838

Regular price $581.00 USD
Regular price Sale price $581.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Cell Biology

Uniprot ID: O95838

Gene Names: GLP2R

Alternative Name(s): GLP-2 receptor; GLP-2-R; GLP-2R

Abbreviation: Recombinant Human GLP2R protein, partial, Biotinylated

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 1-173aa

Protein Length: Partial

Tag Info: C-terminal hFc1-Avi-tagged

Target Protein Sequence: MKLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRPFLTLVLLVSIKQVTGSLLEETTRKWAQYKQACLRDLLKEPSGIFCNGTFDQYVCWPHSSPGNVSVPCPSYLPWWSEESSGRAYRHCLAQGTWQTIENATDIWQDDSECSENHSFKQNVDRYA

MW: 50.0 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20ā„ƒ/-80ā„ƒ. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20ā„ƒ/-80ā„ƒ. The shelf life of lyophilized form is 12 months at -20ā„ƒ/-80ā„ƒ.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4ā„ƒ for up to one week.

Relevance: This is a receptor for glucagon-like peptide 2. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

Reference:

Function:

View full details