Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human FXYD domain-containing ion transport regulator 4(FXYD4)

Recombinant Human FXYD domain-containing ion transport regulator 4(FXYD4)

SKU:CSB-CF009092HU

Regular price $1,692.00 USD
Regular price Sale price $1,692.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P59646

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:DPFANKDDPFYYDWKNLQLSGLICGGLLAIAGIAAVLSGKCKCKSSQKQHSPVPEKAIPLITPGSATTC

Protein Names:Recommended name: FXYD domain-containing ion transport regulator 4

Gene Names:Name:FXYD4 ORF Names:UNQ526/PRO1069

Expression Region:21-89

Sequence Info:full length protein

View full details