Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human ER lumen protein retaining receptor 1(KDELR1)

Recombinant Human ER lumen protein retaining receptor 1(KDELR1)

SKU:CSB-CF012129HU

Regular price $1,821.00 USD
Regular price Sale price $1,821.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P24390

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNLFRFLGDLSHLLAIILLLLKIWKSRSCAGISGKSQVLFAVVFTARYLDLFTNYISLYN TCMKVVYIACSFTTVWLIYSKFKATYDGNHDTFRVEFLVVPTAILAFLVNHDFTPLEILW TFSIYLESVAILPQLFMVSKTGEAETITSHYLFALGVYRTLYLFNWIWRYHFEGFFDLIA IVAGLVQTVLYCDFFYLYITKVLKGKKLSLPA

Protein Names:Recommended name: ER lumen protein retaining receptor 1 Alternative name(s): KDEL endoplasmic reticulum protein retention receptor 1 Short name= KDEL receptor 1 Putative MAPK-activating protein PM23

Gene Names:Name:KDELR1 Synonyms:ERD2.1

Expression Region:1-212

Sequence Info:Full length protein

View full details