Gene Bio Systems
Recombinant Human Epithelial membrane protein 1(EMP1)
Recombinant Human Epithelial membrane protein 1(EMP1)
SKU:CSB-CF007648HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:P54849
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVDASVGLWKNCTNISCSDSLSYASEDA LKTVQAFMILSIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVCWLCILVGVSIYTSHY ANRDGTQYHHGYSYILGWICFCFSFIIGVLYLVLRKK
Protein Names:Recommended name: Epithelial membrane protein 1 Short name= EMP-1 Alternative name(s): CL-20 Protein B4B Tumor-associated membrane protein
Gene Names:Name:EMP1 Synonyms:B4B, TMP
Expression Region:1-157
Sequence Info:Full length protein
