Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human DNA damage-regulated autophagy modulator protein 1(DRAM1)

Recombinant Human DNA damage-regulated autophagy modulator protein 1(DRAM1)

SKU:CSB-CF836675HU

Regular price $1,850.00 USD
Regular price Sale price $1,850.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q8N682

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLCFLRGMAFVPFLLVTWSSAAFIISYVVAVLSGHVNPFLPYISDTGTTPPESGIFGFMI NFSAFLGAATMYTRYKIVQKQNQTCYFSTPVFNLVSLVLGLVGCFGMGIVANFQELAVPV VHDGGALLAFVCGVVYTLLQSIISYKSCPQWNSLSTCHIRMVISAVSCAAVIPMIVCASL ISITKLEWNPREKDYVYHVVSAICEWTVAFGFIFYFLTFIQDFQSVTLRISTEINGDI

Protein Names:Recommended name: DNA damage-regulated autophagy modulator protein 1 Alternative name(s): Damage-regulated autophagy modulator

Gene Names:Name:DRAM1 Synonyms:DRAM

Expression Region:1-238

Sequence Info:full length protein

View full details