Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Cytotoxic T-lymphocyte protein 4 (CTLA4), partial, Biotinylated

Recombinant Human Cytotoxic T-lymphocyte protein 4 (CTLA4), partial, Biotinylated

SKU:P16410

Regular price $224.00 USD
Regular price Sale price $224.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Immunology

Uniprot ID: P16410

Gene Names: CTLA4

Alternative Name(s): Cytotoxic T-lymphocyte-associated antigen 4;CTLA-4;CD antigen CD152

Abbreviation: Recombinant Human CTLA4 protein, partial, Biotinylated

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 37-162aa

Protein Length: Partial

Tag Info: C-terminal mFc-Avi-tagged

Target Protein Sequence: AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDF

MW: 42.6 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.

Reference:

Function:

View full details