Gene Bio Systems
Recombinant Human cytomegalovirus Membrane glycoprotein UL144(UL144)
Recombinant Human cytomegalovirus Membrane glycoprotein UL144(UL144)
SKU:CSB-CF731554HCAT
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Human cytomegalovirus (strain Toledo) (HHV-5) (Human herpesvirus 5)
Uniprot NO.:Q68396
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:KVCQHNEVQLGNECCPPCGSGQRVTKVCTDYTSVTCTPCPNGTYVSGLYNCTDCTQCNVT QVMIRNCTSTNNTVCAPKNHTYFSTPGVQHHKQRQQNHTAHITVKQGKSGRHTLAWLSLF IFLVGIILLILYLIAAYRSERCQQCCSIGKIFYRTL
Protein Names:Recommended name: Membrane glycoprotein UL144 Alternative name(s): TNF alpha-like receptor UL144 UL144 protein
Gene Names:Name:UL144
Expression Region:21-176
Sequence Info:full length protein
