Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Cytochrome b561 domain-containing protein 2(CYB561D2)

Recombinant Human Cytochrome b561 domain-containing protein 2(CYB561D2)

SKU:CSB-CF006308HU

Regular price $1,900.00 USD
Regular price Sale price $1,900.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O14569

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ALSAETESHIYRALRTASGAAAHLVALGFTIFVAVLARPGSSLFSWHPVLMSLAFSFLMT EALLVFSPESSLLHSLSRKGRARCHWVLQLLALLCALLGLGLVILHKEQLGKAHLVTRHG QAGLLAVLWAGLQCSGGVGLLYPKLLPRWPLAKLKLYHATSGLVGYLLGSASLLLGMCSL WFTASVTGAAWYLAVLCPVLTSLVIMNQVSNAYLYRKRIQP

Protein Names:Recommended name: Cytochrome b561 domain-containing protein 2 Alternative name(s): Putative tumor suppressor protein 101F6

Gene Names:Name:CYB561D2 Synonyms:101F6 ORF Names:LUCA12.2

Expression Region:2-222

Sequence Info:Full length protein

View full details