Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Coxsackievirus and adenovirus receptor(CXADR)

Recombinant Human Coxsackievirus and adenovirus receptor(CXADR)

SKU:CSB-CF006237HU

Regular price $1,983.00 USD
Regular price Sale price $1,983.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P78310

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAGLIAGAIIGTLLALALIGLIIFCCRKKRREEKYEKEVHHDIREDVPPPKSRTSTARSYIGSNHSSLGSMSPSNMEGYSKTQYNQVPSEDFERTPQSPTLPPAKVAAPNLSRMGAIPVMIPAQSKDGSIV

Protein Names:Recommended name: Coxsackievirus and adenovirus receptor Short name= CAR Short name= hCAR Alternative name(s): CVB3-binding protein Coxsackievirus B-adenovirus receptor HCVADR

Gene Names:Name:CXADR Synonyms:CAR

Expression Region:20-365

Sequence Info:full length protein

View full details