Gene Bio Systems
Recombinant Human coronavirus 229E Non-structural protein 4a (4a)
Recombinant Human coronavirus 229E Non-structural protein 4a (4a)
SKU:CSB-CF325698HIT
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Human coronavirus 229E (HCoV-229E)
Uniprot NO.:P19739
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:KVSAEVSRQVIQDVKDGTVTFNLLAYTLMSLFVVYFALFKARSHRGRAALIVFKILILFV YVPLLYWSQAYIYATLIAVILLGRFFHTAWHCWLYKTWDFIVFNVTTLCYAR
Protein Names:Recommended name: Non-structural protein 4a Short name= ns4a Alternative name(s): Accessory protein 4a
Gene Names:ORF Names:4a
Expression Region:22-133
Sequence Info:full length protein
