Recombinant Human Complement receptor type 1(CR1),partial

SKU: CSB-EP005932HU

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P17927

Gene Names: CR1

Organism: Homo sapiens (Human)

AA Sequence: GQCNAPEWLPFARPTNLTDEFEFPIGTYLNYECRPGYSGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKGIQFGSQIKYSCTKGYRLIGSSSATCIISGDTVIWDNETPICDRIPCGLPPTITNGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCII

Expression Region: 41-234aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 48.4 kDa

Alternative Name(s): C3b/C4b receptor CD_antigen: CD35

Relevance: Mediates cellular binding of particles and immune complexes that have activated complement. (Microbial infection) Acts as a receptor for Epstein-Barr virus.

Reference: "Identification of distinct C3b and C4b recognition sites in the human C3b/C4b receptor (CR1, CD35) by deletion mutagenesis."Klickstein L.B., Bartow T.J., Miletic V., Rabson L.D., Smith J.A., Fearon D.T.J. Exp. Med. 168:1699-1717(1988)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.