Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Claudin-4(CLDN4)

Recombinant Human Claudin-4(CLDN4)

SKU:CSB-CF005506HU

Regular price $1,814.00 USD
Regular price Sale price $1,814.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O14493

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTG QMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIV AGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGL LCCNCPPRTDKPYSAKYSAARSAAASNYV

Protein Names:Recommended name: Claudin-4 Alternative name(s): Clostridium perfringens enterotoxin receptor Short name= CPE-R Short name= CPE-receptor Williams-Beuren syndrome chromosomal region 8 protein

Gene Names:Name:CLDN4 Synonyms:CPER, CPETR1, WBSCR8

Expression Region:1-209

Sequence Info:Full length protein

View full details