Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Cell cycle control protein 50C(TMEM30C)

Recombinant Human Cell cycle control protein 50C(TMEM30C)

SKU:CSB-CF023827HU

Regular price $1,746.00 USD
Regular price Sale price $1,746.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:A0ZSE6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEERAQHCLSRLLDNSALKQQELPIHRLYFTARRVLFVFFATGIFCLCMGIILILSARSTQEIEINYTRICANCAKLRENASNFDKECTCSIPFYLSGKMMVGEIQETRLTLH

Protein Names:Recommended name: Cell cycle control protein 50C Alternative name(s): Transmembrane protein 30C

Gene Names:Name:TMEM30C Synonyms:CDC50C

Expression Region:1-113

Sequence Info:full length protein

View full details