Skip to product information
1 of 1

GeneBio Systems

Recombinant Human CD70 antigen (CD70), partial

Recombinant Human CD70 antigen (CD70), partial

SKU:P32970

Regular price $504.00 USD
Regular price Sale price $504.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Cancer

Uniprot ID: P32970

Gene Names: CD70

Alternative Name(s): (CD27 ligand)(CD27-L)(Tumor necrosis factor ligand superfamily member 7)(CD antigen CD70)

Abbreviation: Recombinant Human CD70 protein, partial

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 39-193aa

Protein Length: Partial

Tag Info: N-terminal hFc1-tagged

Target Protein Sequence: QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP

MW: 67.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Cytokine which is the ligand for CD27. The CD70-CD27 pathway plays an important role in the generation and maintenance of T cell immunity, in particular during antiviral responses. Upon CD27 binding, induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.

Reference: Molecular and biological characterization of a ligand for CD27 defines a new family of cytokines with homology to tumor necrosis factor.Goodwin R.G., Alderson M.R., Smith C.A., Armitage R.J., Vandenbos T., Jerzy R., Tough T.W., Schoenborn M.A., David-Smith T., Hennen K., Falk B., Cosman D., Baker E., Sutherland G.R., Grabstein K.H., Farrah T., Giri J.G., Beckmann M.P.Cell 73: 447-456(1993)

Function:

View full details