Gene Bio Systems
Recombinant Human Caspase-7(CASP7),partial
Recombinant Human Caspase-7(CASP7),partial
SKU:CSB-RP154794h(A4)
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Apoptosis
Uniprot ID: P55210
Gene Names: CASP7
Organism: Homo sapiens (Human)
AA Sequence: ANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Expression Region: 207-303aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 15.3 kDa
Alternative Name(s): Apoptotic protease Mch-3CMH-1ICE-like apoptotic protease 3 ;ICE-LAP3
Relevance: Involved in the activation cascade of caspases responsible for apoptosis execution. Cleaves and activates sterol regulatory elent binding proteins (SREBPs). Proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Overexpression promotes programmed cell death.
Reference: Mch3, a novel human apoptotic cysteine protease highly related to CPP32.Fernandes-Alnemri T., Takahashi A., Armstrong R.C., Krebs J., Fritz L.C., Tomaselli K.J., Wang L., Yu Z., Croce C.M., Salveson G., Earnshaw W.C., Litwack G., Alnemri E.S.Cancer Res. 55:6045-6052(1995)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.