Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Carbohydrate sulfotransferase 10(CHST10)

Recombinant Human Carbohydrate sulfotransferase 10(CHST10)

SKU:CSB-CF005403HU

Regular price $1,995.00 USD
Regular price Sale price $1,995.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O43529

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHHQWLLLAACFWVIFMFMVASKFITLTFKDPDVYSAKQEFLFLTTMPEVRKLPEEKHIPEELKPTGKELPDSQLVQPLVYMERLELIRNVCRDDALKNLSHTPVSKFVLDRIFVCDKHKILFCQTPKVGNTQWKKVLIVLNGAFSSIEEIPENVVHDHEKNGLPRLSSFSDAEIQKRLKTYFKFFIVRDPFERLISAFKDKFVHNPRFEPWYRHEIAPGIIRKYRRNRTETRGIQFEDFVRYLGDPNHRWLDLQFGDHIIHWVTYVELCAPCEIMYSVIGHHETLEDDAPYILKEAGIDHLVSYPTIPPGITVYNRTKVEHYFLGISKRDIRRLYARFEGDFKLFGYQKPDFLLN

Protein Names:Recommended name: Carbohydrate sulfotransferase 10 EC= 2.8.2.- Alternative name(s): HNK-1 sulfotransferase Short name= HNK-1ST Short name= HNK1ST Short name= HuHNK-1ST

Gene Names:Name:CHST10

Expression Region:1-356

Sequence Info:full length protein

View full details