Recombinant Human Cancer-testis antigen 2(CTAG2)

Recombinant Human Cancer-testis antigen 2(CTAG2)

CSB-YP006127HUa4
Regular price
$885.00 USD
Sale price
$885.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: O75638

Gene Names: CTAG2

Organism: Homo sapiens (Human)

AA Sequence: MQAEGQGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAASAQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFMSVRDQDREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRPGTPGPPPPEGAQGDGCRGVAFNVMFSAPHI

Expression Region: 1-210aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-sumostar-tagged

MW: 37.1 kDa

Alternative Name(s): Autoimmunogenic cancer/testis antigen NY-ESO-2 Cancer/testis antigen 6.2 Short name: CT6.2 L antigen family member 1 Short name: LAGE-1 ESO2, LAGE1

Relevance:

Reference: "CD4+ Th2 cell recognition of HLA-DR-restricted epitopes derived from CAMEL: a tumor antigen translated in an alternative open reading frame." Slager E.H., Borghi M., van der Minne C.E., Aarnoudse C.A., Havenga M.J., Schrier P.I., Osanto S., Griffioen M. J. Immunol. 170:1490-1497(2003)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.