Recombinant Human C-C chemokine receptor type 8(CCR8),partial,Nanodiscs

Recombinant Human C-C chemokine receptor type 8(CCR8),partial,Nanodiscs

CSB-CF004847HU2-N
Regular price
$1,242.00 USD
Sale price
$1,242.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size:20ug. Other sizes are also available. For further information, please contact us.

Research Areas:G-protein coupled receptor, Receptor, Transducer

Uniprot ID:P51685

Gene Names:CCR8

Organism:Homo sapiens (Human)

AA Sequence:LLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSSMFFITLMSV

Expression Region:74-129aa

Sequence Info:Partial

Source:in vitro E.coli expression system

Tag Info:N-terminal 10xHis-tagged

MW:9.4 kDa

Alternative Name(s):CC chemokine receptor CHEMR1;CMKBRL2Chemokine receptor-like 1;CKR-L1;GPR-CY6;GPRCY6;TER1;CDw198

Relevance:Receptor for the chemokine CCL1/SCYA1/I-309. May regulate monocyte chemotaxis and thymic cell line apoptosis. Alternative coreceptor with CD4 for HIV-1 infection.

Reference:"The assignment of chemokine-chemokine receptor pairs: TARC and MIP-1 beta are not ligands for human CC-chemokine receptor 8." Garlisi C.G., Xiao H., Tian F., Hedrick J.A., Billah M.M., Egan R.W., Umland S.P. Eur. J. Immunol. 29:3210-3215(1999)

Purity:Greater than 90% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:18-23 business days

You may also like

  • Recombinant Human C-C chemokine receptor type 8(CCR8),partial
    Regular price
    $1,020.00 USD
    Sale price
    $1,020.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human C-C chemokine receptor type 4(CCR4),partial
    Regular price
    $621.00 USD
    Sale price
    $621.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human C-C chemokine receptor type 8(CCR8)-VLPs (Active)
    Regular price
    $3,661.00 USD
    Sale price
    $3,661.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human C-C chemokine receptor type 8(CCR8)
    Regular price
    $1,832.00 USD
    Sale price
    $1,832.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share