Skip to product information
1 of 1

GeneBio Systems

Recombinant Human C-C chemokine receptor type 1 (CCR1), partial

Recombinant Human C-C chemokine receptor type 1 (CCR1), partial

SKU:P32246

Regular price $703.00 USD
Regular price Sale price $703.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Immunology

Uniprot ID: P32246

Gene Names: CCR1

Alternative Name(s): (C-C CKR-1)(CC-CKR-1)(CCR-1)(CCR1)(HM145)(LD78 receptor)(Macrophage inflammatory protein 1-alpha receptor)(MIP-1alpha-R)(RANTES-R)(CD antigen CD191)

Abbreviation: Recombinant Human CCR1 protein, partial

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 306-355aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-SUMO-tagged

Target Protein Sequence: ERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHELSAGF

MW: 18.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Receptor for a C-C type chemokine. Binds to MIP-1-alpha, MIP-1-delta, RANTES, and MCP-3 and, less efficiently, to MIP-1-beta or MCP-1 and subsequently transduces a signal by increasing the intracellular calcium ions level. Responsible for affecting stem cell proliferation.

Reference: "Human LZIP binds to CCR1 and differentially affects the chemotactic activities of CCR1-dependent chemokines." Ko J., Jang S.W., Kim Y.S., Kim I.S., Sung H.J., Kim H.-H., Park J.Y., Lee Y.H., Kim J., Na D.S. FASEB J. 18: 890-892(2004)

Function:

View full details