Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human BolA-like protein 1(BOLA1)

Recombinant Human BolA-like protein 1(BOLA1)

SKU:CSB-YP002774HU

Regular price $924.00 USD
Regular price Sale price $924.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Cell Biology

Uniprot ID: Q9Y3E2

Gene Names: BOLA1

Organism: Homo sapiens (Human)

AA Sequence: MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP

Expression Region: 1-137aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 16.3 kDa

Alternative Name(s): hBolA

Relevance:

Reference: Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C.Genome Res. 10:703-713(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details