Recombinant Human BH3-like motif-containing cell death inducer(BLID)

Recombinant Human BH3-like motif-containing cell death inducer(BLID)

CSB-EP818276HU
Regular price
$690.00 USD
Sale price
$690.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cell Biology

Uniprot ID: Q8IZY5

Gene Names: BLID

Organism: Homo sapiens (Human)

AA Sequence: MVTLLPIEGQEIHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEALLGSNKEPMLPKETVLSLKRYNLGSSAMKRNVPGHVLQRPSYLTRIQVTLLCNSSAEAL

Expression Region: 1-108aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 39 kDa

Alternative Name(s): Breast cancer cell protein 2

Relevance: Functions as a proapoptotic molecule through the caspase-dependent mitochondrial pathway of cell death.

Reference: "BRCC2, a novel BH3-like domain-containing protein, induces apoptosis in a caspase-dependent manner." Broustas C.G., Gokhale P.C., Rahman A., Dritschilo A., Ahmad I., Kasid U. J. Biol. Chem. 279:26780-26788(2004)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.