Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Beta-defensin 130(DEFB130)

Recombinant Human Beta-defensin 130(DEFB130)

SKU:CSB-YP653750HU

Regular price $1,201.00 USD
Regular price Sale price $1,201.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: Q30KQ2

Gene Names: DEFB130

Organism: Homo sapiens (Human)

AA Sequence: GVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP

Expression Region: 23-79aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 8.3 kDa

Alternative Name(s): Beta-defensin 30 Short name: DEFB-30 Defensin, beta 130

Relevance: Has antibacterial activity.

Reference: "Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract."Patil A.A., Cai Y., Sang Y., Blecha F., Zhang G.Physiol. Genomics 23:5-17(2005)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details