Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Beta-2-glycoprotein 1 (APOH), partial

Recombinant Human Beta-2-glycoprotein 1 (APOH), partial

SKU:P02749

Regular price $701.00 USD
Regular price Sale price $701.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Cardiovascular

Uniprot ID: P02749

Gene Names: APOH

Alternative Name(s): (APC inhibitor)(Activated protein C-binding protein)(Anticardiolipin cofactor)(Apolipoprotein H)(Apo-H)(Beta-2-glycoprotein I)(B2GPI)(Beta(2)GPI)

Abbreviation: Recombinant Human APOH protein, partial

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 119-345aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-GST-tagged

Target Protein Sequence: ADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

MW: 56.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Binds to various kinds of negatively charged substances such as heparin, phospholipids, and dextran sulfate. May prevent activation of the intrinsic blood coagulation cascade by binding to phospholipids on the surface of damaged cells.

Reference: "Purification of apolipoprotein H (beta 2-glycoprotein I)-like protein from human follicular fluid." Aleporou-Marinou V., Pappa H., Yalouris P., Patargias T. Comp. Biochem. Physiol. 128B: 537-542(2001)

Function:

View full details