Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Bcl-2-like protein 10(BCL2L10)

Recombinant Human Bcl-2-like protein 10(BCL2L10)

SKU:CSB-CF884627HU

Regular price $1,796.00 USD
Regular price Sale price $1,796.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9HD36

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGY PGNRFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQ EGDVARDCQRLVALLSSRLMGQHRAWLQAQGGWDGFCHFFRTPFPLAFWRKQLVQAFLSC LLTTAFIYLWTRLL

Protein Names:Recommended name: Bcl-2-like protein 10 Short name= Bcl2-L-10 Alternative name(s): Anti-apoptotic protein NrH Apoptosis regulator Bcl-B

Gene Names:Name:BCL2L10 Synonyms:BCLB

Expression Region:1-194

Sequence Info:full length protein

View full details