Gene Bio Systems
Recombinant Human B-cell antigen receptor complex-associated protein alpha chain(CD79A)
Recombinant Human B-cell antigen receptor complex-associated protein alpha chain(CD79A)
SKU:CSB-CF004957HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:P11912
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEKP
Protein Names:Recommended name: B-cell antigen receptor complex-associated protein alpha chain Alternative name(s): Ig-alpha MB-1 membrane glycoprotein Membrane-bound immunoglobulin-associated protein Surface IgM-associated protein CD_antigen= CD79a
Gene Names:Name:CD79A Synonyms:IGA, MB1
Expression Region:33-226
Sequence Info:full length protein
