Skip to product information
1 of 1

GeneBio Systems

Recombinant Human B- and T-lymphocyte attenuator (BTLA), partial, Biotinylated

Recombinant Human B- and T-lymphocyte attenuator (BTLA), partial, Biotinylated

SKU:Q7Z6A9

Regular price $604.00 USD
Regular price Sale price $604.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Immunology

Uniprot ID: Q7Z6A9

Gene Names: BTLA

Alternative Name(s): (B- and T-lymphocyte-associated protein)(CD antigen CD272)

Abbreviation: Recombinant Human BTLA protein, partial, Biotinylated

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 31-150aa

Protein Length: Partial

Tag Info: C-terminal mFc-Avi-tagged

Target Protein Sequence: KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMAS

MW: 42.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Inhibitory receptor on lymphocytes that negatively regulates antigen receptor signaling via PTPN6/SHP-1 and PTPN11/SHP-2. May interact in cis (on the same cell) or in trans (on other cells) with TNFRSF14. In cis interactions, appears to play an immune regulatory role inhibiting in trans interactions in naive T cells to maintain a resting state. In trans interactions, can predominate during adaptive immune response to provide survival signals to effector T cells.

Reference: "T cell intrinsic heterodimeric complexes between HVEM and BTLA determine receptivity to the surrounding microenvironment." Cheung T.C., Oborne L.M., Steinberg M.W., Macauley M.G., Fukuyama S., Sanjo H., D'Souza C., Norris P.S., Pfeffer K., Murphy K.M., Kronenberg M., Spear P.G., Ware C.F. J. Immunol. 183: 7286-7296(2009)

Function:

View full details