Gene Bio Systems
Recombinant Human ATP synthase lipid-binding protein, mitochondrial(ATP5G3)
Recombinant Human ATP synthase lipid-binding protein, mitochondrial(ATP5G3)
SKU:CSB-CF002361HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:P48201
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAM GLFCLMVAFLILFAM
Protein Names:Recommended name: ATP synthase lipid-binding protein, mitochondrial Alternative name(s): ATP synthase proteolipid P3 ATPase protein 9 ATPase subunit c
Gene Names:Name:ATP5G3
Expression Region:68-142
Sequence Info:Full length protein
