Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Cancer
Uniprot ID: O14497
Gene Names: ARID1A
Organism: Homo sapiens (Human)
AA Sequence: SLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMM
Expression Region: 1976-2231aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW: 33.4 kDa
Alternative Name(s): B120 BRG1-associated factor 250 Short name: BAF250 BRG1-associated factor 250a Short name: BAF250A Osa homolog 1 Short name: hOSA1 SWI-like protein SWI/SNF complex protein p270 SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1 hELD C1orf4, OSA1, SMARCF1
Relevance: Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Binds DNA non-specifically. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth
Reference: "A specificity and targeting subunit of a human SWI/SNF family-related chromatin-remodeling complex." Nie Z., Xue Y., Yang D., Zhou S., Deroo B.J., Archer T.K., Wang W. Mol. Cell. Biol. 20:8879-8888(2000)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.