Recombinant Human Annexin A5(ANXA5)

Recombinant Human Annexin A5(ANXA5)

CSB-YP001846HU
Regular price
$770.00 USD
Sale price
$770.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Cardiovascular

Target / Protein: ANXA5

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: P08758

AA Sequence: AQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD

Tag info: N-terminal 6xHis-tagged

Expression Region: 2-320aa

Protein length: Full Length

MW: 37.8 kDa

Alternative Name(s): Anchorin CII;Annexin V;Annexin-5;Calphobindin I ;CBP-IEndonexin II;Lipocortin V;Placental anticoagulant protein 4 ;PP4Placental anticoagulant protein I ;PAP-I;Thromboplastin inhibitor;Vascular anticoagulant-alpha ;VAC-alpha

Relevance: This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.

Reference: Primary structure of human placental anticoagulant protein.Funakoshi T., Hendrickson L.E., McMullen B.A., Fujikawa K.Biochemistry 26:8087-8092(1987)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share